--%>

Determine the total charge for each peptide at ph 70 then


Question - Three polypeptides listed below are in a mixture. Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly (i.e. elute first) through a strong anion-exchange resin at pH 7.0?

ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG

GPYFGDEPLDVHDEPEEG

PHLLSAWKGMEGVGKSQSFAALIVILA

Solution Preview :

Prepared by a verified Expert
Chemistry: Determine the total charge for each peptide at ph 70 then
Reference No:- TGS02502308

Now Priced at $25 (50% Discount)

Recommended (96%)

Rated (4.8/5)